Chers amis lecteurs solidmar,


Solidmar est fatigué ! Trop nourri ! En 8 ans d’existence il s’est goinfré de près de 14 000 articles et n’arrive plus à publier correctement les actualités. RDV sur son jumeau solidmar le 2ème !




Pages

samedi 19 septembre 2009

On réprime, on arrête même les intentions!



Par Abdelghani Kabbaj, 19/9/2009

Selon le journal "assabah", 15 citoyens sont condamnés à des peines allant de 1 mois et 12 mois de prison ferme pour avoir «déjeuné" publiquement en plein mois de ramadan. Ces personnes ont été arrêtées et condamnés à Casablanca.

Selon plusieurs journaux, des jeunes du «Mouvement alternatif pour les libertés individuelles» (MALI) ont pu défier les chroniques banales qui gèrent notre quotidien banal. Organiser un «déjeune» pendant le Ramadan dans une forêt hors de la ville de Mohammedia.
L’audace des 15 citoyens condamnés à Casa et du «Mouvement alternatif pour les libertés individuelles» ne va pas passer inaperçue car la tolérance au Maroc bénéficie pas aux marocains non croyants.


La police marocaine a procédé donc à l'arrestation et l'interrogatoire des membres de ce Mouvement défendant les libertés individuelles et qui allaient participer dans une forêt près de Mohamadia, loin des regards pour ne pas être provocateurs, à un "déjeuner". Ainsi sont arrêtés et mis en examen dès mardi et mercredi, 15 et 16 septembre, La journaliste Zaïneb El Rhazoui, la médecin psy. Ibtissam Lachgar, Salah Abrah, Nizar Bnamt, Aziz Yaäkoubi (journaliste) et Abderrhim Moktafi. Nous ne connaissons pas le sort que leur réserve le Pouvoir et sa justice.
Aussi, une manifestation qui allait avoir lieu devant la Gare à Mohamadia pour dénoncer l'intension d'exprimer le droit à la différence et de déjeuner ramadan a été interdite.


Mais le pire c'est que les démocrates marocains, les intellectuels, les politiques et les activistes de la Société Civile, ont avalé leur langue et n'osent pas ouvrir un débat sur les libertés individuelles et les libertés publiques, sur la laïcité et la séparation entre Etat et religion et surtout la liberté religieuse ...
L'absence d'un débat public, organisé et structuré, ne profite qu'aux extrémistes islamistes ou autres.
En laissant l'Etat et ses appareils policiers et judiciaires réglementer et "résoudre", à leur façon, les problèmes et problématiques que posent la pratique de ces libertés individuelles et publiques n'avance en rien l'émancipation de notre société et son développement vers un Etat de Droit, de démocratie et des droits de l'homme dont l'Etat du Maroc ne cesse nullement de vanter le respect bien que la réalité de ces droits laisse à désirer et sont quotidiennement bafoués.


De nos jours au Maroc, tout acte, déclaration ou idées (même émanant de penseurs et intellectuels musulmans libres prônant un Islam moderne et démocratique) jugés contre les préceptes séculaires d’un Islam rétrograde sont décriés et accusés par les faqihs et les politiciens conservateurs qui ont peur d’être dépassés par le cours de la rationalité moderniste et démocratique qui pourrait gagner le mouvement social en perpétuelle mutation. Le conservatisme a gagné même «Bayane al Yaoum» (et d'autres journaux dits progressistes), journal de l’ex-parti communiste, qui qualifie cet acte d’«envie infantile».
Certes, la réalité sociale et politique du Maroc et du peuple marocain, encore sous-développé en démocratie, en conditions sociales, économiques, civiques, culturelles..., n'a rien à faire de problèmes qui semblent marginaux. Mais respecter les libertés individuelles, selon les chartes et conventions internationales des droits humains dont le Maroc est signataire, n'a rien de marginal car respecter les convictions et croyances individuelles et en assurer et garantir leur pratique, dans le respect des autres convictions et croyances est un problème majeur qui entrave l'accès de la Société et les simples citoyennes et citoyens marocains au civisme et au respect mutuel des droits humains et à la démocratie.
Or les faqihs déguisés en politiciens et les politiciens «habillés» en faqihs affirment, ouvertement ou en catimini, qu’il ne faille pas déroger et désobéir à la religion du peuple (on amalgame tous les citoyennes citoyens dans le concept PEUPLE) et que «déjeuner» au mois du ramadan n’a rien à avoir avec la liberté individuelle!... et que tant que la religion Musulmane est la religion de l’Etat marocain, il ne faut pas permettre d’enfreindre aux lois «islamiques».


N’est-ce pas là un cheminement vers le totalitarisme politique sous-développé au nom de l’Islam! Or un Etat qui se veut islamique, donc religieux, ne peut qu'être totalitaire idéologiquement, spirituellement et même politiquement.


Ce qui est abject c’est que la majorité de nos élites politiques et religieuses ne cessent de parler de la tolérance et de l’ouverture d’esprit de notre Système politico-religieux et des islamistes marocains! Ils crient à qui veut les croire qu’au Maroc personne n’est emprisonné pour avoir rompu ou "cassé" le ramadan avant le coucher du soleil! Mensonge! Depuis longtemps, des citoyens ont été appréhendés et jugés pour le délit de "rompre" le ramadan durant l'horaire du jeûne. La police et les autorités ont même, dans plusieurs cas, transgressé et attaqués des domiciles pour arrêter et traduire en justice ces rompre "rompeurs" du jeûne.
La liberté, certes, ne peut jamais être absolue! Et cela doit être valable pour musulmans conservateurs et pratiquants comme pour musulmans modernistes et pour les non pratiquants et aussi même pour agnostiques et incroyants.

Le Maroc de la répression est en marche! On réprime, on arrête même les intensions !
Abdelghani, ex cadre de 23 mars ( tendance marxiste léniniste), ex prisonnier politique, ex membre du bureau politique du PSU, aujourd'hui militant sur les différents fronts de la résistance, contribue oralement et par écrit aux débats...Il vient de publier un livre relatif à la répression au Maroc...
A.F.

Khouribga terrorisée...la résistance continue !

Par Ali Fkir, 19/9/2009

Allons-nous assister à un massacre?
En ce moment même, 17h10 du samedi 19 septembre 2009, les différentes forces de répression investissent le centre de la médina de la ville de Khouribga (capitale minière du pays) et les ruelles avoisinantes, terrorisant les 850 prolétaires abusivement licenciés par l'OCP (groupe étatique et 1ère unité économique du pays), leurs familles et toute la population de la ville.

Rappelons que ces derniers jours des "pourparlers" ont eu lieu entre les ouvriers et les autorités locales. Ces dernières ont proposé des "solutions" qui ne visent en réalité qu'à innocenter l'OCP et à entériner sa décision arbitraire et illégale.
Les ouvriers ont rejeté ces propositions, et demandent des négociations directes entre l'OCP et leur bureau syndical en vue de la réintégration inconditionnelle de toutes les victimes.
A la veille de l'aïd al fitre, fête religieuse musulmane, les milliers d'enfants des ouvriers vivent un vrai cauchemar, les centaines de mamans un vrai drame.
LA SOLIDARITÉ NOUS INTERPELLE

Par Assal Hajjaj
الآن تضرب القوات القمعية بأعداد كثيفة : من تدخل سريع للأمن والقوات المساعدة وأجهزة الأمن السرية والعلنية، حصارا رهيبا على ساحة المسيرة لمنع عمال سميسي ريجي وعائلاتهم من تنفيذ اعتصامهم المقرر ابتداء من الساعة الرابعة مساء، كما أنها تقوم بإخلاء الشوارع القريبة من الساحة من المواطنين بطريقة هستيرية حتى يتسنى لها سحق العمال
ولنا عودة في الموضوع
La répression s'accentue
la résistance continue

Après l'occupation de la médina, lieu où devrait se dérouler le sit in ouvrier (19/03/2009), les 850 ouvriers ont évité la confrontation avec les divers corps de répressions (dont certains sont venus en renfort des autres villes). Les ouvriers ont regagné le siège de leur syndicat, l'UMT, (siège encerclé par les forces de répression).
A 22h les ouvriers ont quitté les lieux.
La lutte continue

L’ASDHOM condamne l’intervention brutale des forces de l’ordre à Khouribga



Par le bureau executif de l' ASDHOM, Paris, 17/9/2009
asdhom@asdhom.org

Le fleuron de l’économie marocaine fait parler de lui et de la plus détestable des manières. L’Office Chérifien des Phosphates (OCP) s’appuie sur les forces de l’ordre pour empêcher et mater un sit-in pacifique que tentaient d'organiser les ouvriers de la société SMSI-Régie (société appartenant au groupe OCP) devant son siège social de Khouribga.


Ces ouvriers, soutenus par des syndicalistes et des défenseurs des droits humains, voulaient juste attirer l’attention des responsables de l’OCP, de l’opinion publique et des autorités marocaines sur le drame que vivent les 850 ouvriers licenciés abusivement par la société SMSI-Régie. Forts du soutien du syndicat UMT (Union Marocaine du Travail) et d’autres associations démocratiques de la société civile telle l’AMDH qui a organisé le 13 septembre 2009 une caravane sur Khouribga, les ouvriers ont mené une série d’actions pour réclamer la réintégration des licenciés.


L’OCP n’a que faire de leurs doléances. Il leur tourne le dos et leur refuse le dialogue social. Il est même allé un peu plus loin le mardi 15 septembre quand il a fait appel aux services des forces de l’ordre. Ces derniers n’ont pas fait dans le détail. L’assaut s’est soldé par plusieurs bléssés parmi les ouvriers et leurs familles venues les soutenir. 44 arrestations ont été opérées dont 4 parmi les délégués syndicaux UMT présents au sit-in.


Conduits au commissariat, les ouvriers y ont subi de longs interrogatoires, insultes et intimidations. Après les avoir dissuadés de la poursuite de leur mouvement revendicatif, les autorités locales ont procédé à la libération des 40 ouvriers arrêtés et ont signifié aux 4 délégués syndicaux la comparution devant la tribunal de 1ère instance le mardi 29 septembre 2009. Il s’agit de : OUASSIF Jilali, BELOUAFI Rachid, BOUKDIR Abderrahman et FAKHORI Omar.




L’ASDHOM considère que ces licenciements sont injustes et abusifs. Elle apporte tout son soutien aux 850 familles brisées et se joint à tous les syndicalistes et les défenseurs des droits humains qui se sont courageusement mobilisés pour réclamer la réintégration des ouvriers licenciés.
L’ASDHOM dénonce vigoureusement la violence des forces de l’ordre à l’égard des manifestants et leurs familles et demande d’abandonner immédiatement les poursuites judiciaires engagées contre les quatre militants syndicaux.
L’ASDHOM interpelle les responsables marocains à quelque niveau que ce soit pour veiller au respect de la dignité de ces travailleurs et pour engager un vrai dialogue social avec leurs représentants afin de trouver une solution à leur calvaire.
L’ASDHOM ne ménagera pas ses efforts pour sensibiliser l’opinion nationale et internationale à la situation sociale des ouvriers licenciés de SMSI-Régie qui ne cesse de se dégrader et faire porter la responsabilité à l’Etat Marocain, propriétaire du groupe OCP, qui ne respecte pas ses engagements en matière de liberté syndicale.


asdhom@asdhom.org

Maroc : « Les Dieux sont tombés sur la tête »


Par le bureau exécutif de l'ASDHOM, Paris, 20/9/2009

Six jeunes marocains dont une femme se revendiquant du MALI -un Mouvement Alternatif pour les Libertés Individuelles- ont été embarqués le dimanche 13 septembre 2009 par la police judiciaire de la ville de Mohammedia (non loin de la capitale Rabat) au moment où ils s’apprêtaient à organiser un rassemblement pour rompre publiquement le jeûne du ramadan.

Ce groupe, dit groupe des « non jeûneurs », entendait protester contre un article du code pénal -article 222- qui « punit la non observation du jeûne pendant ramadan au Maroc » et qui stipule : « Celui qui, notoirement connu pour son appartenance à la religion musulmane, rompt ostensiblement le jeûne dans un lieu public pendant le temps de ramadan, sans motif admis par cette religion, est puni de l'emprisonnement d'un à six mois et d'une amende de 12 à 120 dirhams ». Ce groupe, créé récemment sur Facebook, se fixe comme objectif la défense de la liberté personnelle, la liberté d’opinion et la liberté de conscience et de culte (voir son site sur Facebook)
http://www.facebook.com/group.php?gid=128065536460&ref=ts
Son intention était d’exprimer une opinion d’ailleurs largement partagée par tous les défenseurs des droits de l’Homme et qui relève la contradiction flagrante entre le code pénal et la juridiction marocaine d’une part, la constitution marocaine et les textes internationaux relatifs aux droits de l’Homme, notamment l’article 18 de la Déclaration Universelle des Droits de l’Homme, d’autre part qui stipule : "Toute personne a droit à la liberté de pensée, de conscience et de religion ; ce droit implique la liberté de changer de religion ou de conviction ainsi que la liberté de manifester sa religion ou sa conviction seule ou en commun, tant en public qu'en privé, par l'enseignement, les pratiques, le culte et l'accomplissement des rites."
Les membres des forces de l’ordre qui ont participé à l’évacuation musclée du groupe n’ont pas entendu les appels des militants de l’AMDH, présents au moment des faits. Le groupe a été embarqué vers une destination inconnue.
L’ASDHOM qualifie cette évacuation d’enlèvement déguisé puisque sur tout le groupe, seuls cinq ont été ramenés chez eux le vendredi 18 septembre à 2h du matin après s’être fait déposséder de leurs téléphones portables et avec obligation de se présenter la journée au commissariat d’Al Mohammedia pour les « besoins de l’enquête ».
Le traitement sécuritaire et médiatique de cette affaire nous inquiète. L’intervention du Conseil des Oulémas (Théologiens) qui a qualifié cet évènement d’"odieux qui défie les enseignements de dieu et du prophète avec tout ce qu'il engendre comme sanction grave" donne le ton. Cela nous rappelle l’affaire de Kser El Kébir où une vindicte populaire était lancée contre des personnes soupçonnées d’avoir organisé un « mariage homosexuel » et les arrestations abusives du 14 mars 2009 qui ont touché 25 citoyens soupçonnés d'homosexualité lors du Moussem Sidi Ali Ben Hamdouch (Région de Meknès).
L’ASDHOM a toutes les raisons de s’inquiéter du sort qui sera réservé à ce groupe dont les opinions ne semblent pas du tout du goût des gouvernants. Sa sécurité physique est hautement en jeu.
Les dernières arrestations arbitraires en dehors de tout cadre légal d’une dizaine de journalistes qui ont osé publier des articles relatifs à l’état de santé du chef de l’Etat ne sont pas pour nous rassurer. Nous sommes encore plus inquiets quand on sait qu’à Fès, les forces de l’ordre ont exhibé à la face de la population locale d’un quartier de la Médina quatre détenus (présumés innocents, car non encore jugés), menottés et torse nu, tel un trophée de chasse.
L’ASDHOM condamne fermement ces agissements sécuritaires et demande à l’Etat marocain de se conformer à ses engagements en matière de respect des libertés fondamentales. Elle considère que l’article 222 du code pénal marocain est anticonstitutionnel et exige par conséquent son abrogation.
L’ASDHOM considère qu’une réforme en profondeur de la justice en garantissant son indépendance de l’exécutif est nécessaire. La loi marocaine doit être en harmonie avec le référentiel universel en matière des droits de l’Homme. C’est une urgence et l’ASDHOM ne fait là que rappeler une recommandation d’une certaine IER.
En attendant, l’ASDHOM réclame la libération immédiate des détenus d’opinion et l’arrêt des poursuites engagées contre le groupe des « non jeûneurs ».

vendredi 18 septembre 2009

L'art (médiéval) de susciter la haine et le lynchage....

Bienvenue dans le pays Moyen-Âge...
Azim Moslih

Cinq détenus "non jeûneurs" ont été emmenés (vers 2h du matin du vendredi 18 septembre 2009) passer la nuit chez eux et se représenter le jour même au commissariat de Mohammedia pour la suite de l'enquête. Leurs tél portables leurs ont été confisqués, de même qu'on leur a interdit de communiquer ou "bavarder" avec quiconque
Ali Fkir
Avis aux membres du groupe MALI
À l'attention des membres de
MALI مالي
Un grand salut à tout le monde,
A cause de descente massive de personnes ne connaissant pas les règles du débat démocratique, s'amusant à injurier, voire de menacer les membres du groupe MALI tout espace de discussion est fermé, jusqu'à la sortie de nos amis actuellement en garde à vue. Cela permettra de maintenir le groupe et de l'améliorer en attendant la réouverture d'un VRAI DÉBAT démocratique, dans le calme et la tolérance.

Une occupation militaire qui ne dit pas son nom

Philippines –USA : Dix ans de VFA (Accord sur les forces en visite), une évaluation
par Roland G. SIMBULAN

MANILLE – La présence de soldats usaméricains lourdement armés jusque dans les campagnes philippines les plus reculées fait désormais partie du paysage local. Nous marquons, cette année, les dix ans (1999-2009) de l’Accord sur les forces en visite (VFA – Visiting Forces Agreement), ratifié par le Sénat des Philippines le 27 mai 1999, accord qui a fait de nos campagnes une zone de tir libre pour les « exercices militaires conjoints » utilisant des munitions réelles et de l’artillerie qui a tué, blessé ou mutilé nos gens, y compris des enfants. Ces forces étrangères sont entrées en territoire philippin sans passeports ni visas, sans autorisations de la part de nos douanes ni de la part de nos autorités d’immigration, sans mise en quarantaine de la part de nos autorités sanitaires, et sans permis, ni immatriculation pour conduire leurs véhicules dans notre pays. Elles ont échappé à la justice après avoir commis des meurtres, des tentatives de meurtre, des viols, des harcèlements de nos femmes, des mauvais traitements de nos compatriotes et la destruction de notre environnement. Un document appelé l’Accord sur les forces en visite (VFA) leur a donné le droit de faire tout cela.


Plus de 40.000 soldats usaméricains sont ainsi entrés en territoire philippin dans plus de 25 provinces depuis l’entrée en vigueur du VFA en 1999. Ils sont arrivés dans plus de 78 vaisseaux et flotilles de la marine usaméricaine, comptant des porte-avions avec des armes nucléaires, des croiseurs, des sous-marins –tout cela en violation flagrante de la Constitution des Philippines qui interdit l’entrée d’armes nucléaires dans une partie quelconque du pays.


Le VFA est la plus grave anomalie dont souffrent nos relations étrangères aujourd’hui, 17 ans après le démantèlement historique des bases militaires usaméricaines en 1992. C’est un document éhonté à sens unique, puisqu’il n’est pas réciproque. Il va à l’encontre de la disposition constitutionnelle des Philippines qui prévoit « une égalité de la protection légale» par le simple fait qu’il assure des droits et privilèges spéciaux à des forces armées étrangères sur le territoire des Philippines. Le VFA a été une indignité envers notre peuple, un travestissement pour nos droits et notre État de droit. C’est pourquoi les Philippins de tous les milieux, partout dans le pays, continuent à manifester contre le soi-disant traité. Il nous rappelle que nous ne sommes pas encore vraiment souverains sur notre propre territoire en tant que nation.


Le VFA est par conséquent un mauvais exemple pour les autres accords militaires proposés ou en instance avec les autres pays tel que le Statut philippino-australien de l’Accord des forces en visite qui est toujours en examen au Sénat, ou les projets d’accord avec Singapour et la Nouvelle-Zélande. Ces derniers utilisent ostensiblement le VFA avec les USA comme modèle.


Le VFA est-il légal et constitutionnel ?


Il est clair que les décisions de la Cour Suprême en 2000 et 2009 sur le VFA ne permettent que des exercices militaires conjoints comme Balikatan (épaule contre épaule), ainsi que des exercices d’entraînement de petites unités mixtes. Elle n’accorde pas de droits pour la construction de bases ou d’installations pour des forces US de passage en visite aux Philippines. Elle n’autorise pas non plus les forces US à prendre part à des opérations de contre-insurrection dans le pays.


Protestation contre le VFA, 2008

Lire la suite


Original : Bulatlat-Ten Years of the VFA: An Assessment

TAMAZIGHT Filippin: Iγallen imarikaniyen "inebgawen"

DEUTSCH Die Militärbesatzung der Philippinen durch die US-Armee: eine unendliche Geschichte?


Hafsa, la tante du roi récidive !


Par Aziz Akkaoui, 19/9/2009

Des membres de la famille de l'enfant Soumia - jeune fille de 16 ans- ont contacté aujourd'hui jeudi 17 septembre 2009 la section de l'AMDH Khénifra pour demander son soutien suite à l' "enlèvement" et à la "séquestration" de la jeune fille par Hafsa Amahzoune pendant un mois avant d'être rejetée devant la porte de chez elle dans état d'amnésie totale ..

Le médecin de l'hôpital provincial a refusé de l'admettre et a conseillé aux membres de sa famille d'aller voir du coté de la police !!!

Les membres du bureau local AMDH se sont déplacés au commissariat de police suite à quoi une ambulance a été dépêchée sur place pour transporter Soumia à l'hôpital où elle a été admise cette fois ci mais sous les regards indifférents des médecins comme pour attendre des instructions . Ils ont même demandé à sa famille de la ramener à la maison en attendant demain. Chose que la famille a refusé et elle a eu gain de cause .

Soumia est toujours à l'hôpital et devrait normalement être examinée par un psychiatre ,un gynécologue et devrait normalement subir des analyses de sang car sa famille soupçonne qu’on lui ait inoculé une drogue forte .

D'après la déclaration écrite dont dispose le bureau de l'AMDH , sa famille avait porté plainte auprès de la police mais vainement ; on leur aurait répondu qu'il est impossible d'approcher la maison de Hafsa !!!

Soumia la jeune fille de 16 ans "enlevée" et "séquestrée" par Hafsa porte une cicatrice sur l'avant bras de la main gauche comme si elle avait tenté un suicide .

Les militants de l'AMDH Khénifra présents en bon nombre à l'hôpital pour soutenir la famille de Soumia suivent l'affaire de très près .

Il est à noter aussi que les responsables de la police judiciaire , le commissaire central, les services de renseignement de la police et de la gendarmerie de la province la- DAG- se sont mobilisés à l'hôpital et chuchotent avec les médecins !!

Espérons que la procédure suivra son cours normal et que le procureur du roi fasse son devoir, la famille a décidé de porter plainte officiellement demain vendredi matin .

L'AMDH a rendu public un communiqué à ce propos .

SOUMIA


الجمعية المغربية لحقوق الإنسان
فرع خنيفرة.

بــــــــــــــــــــــــلاغ

توصل فرع الجمعية المغربية لحقوق الإنسان بخنيفرة , اليوم الخميس 17 شتنبر 2009 على الساعة السابعة والنصف مساء بطلب مؤازرة "شفويا" من طرف أسرة الطفلة عطار سامية "16 سنة" مفاده أن ابنتهم تعرضت للاختطاف مدة شهر من طرف حفصة أمحزون ورغم اتصال العائلة بالشرطة لإخبارهم بمكان تواجد الطفلة سامية لم تحرك ساكنا حيث صرح احد أفراد الشرطة لخالتها "انه يستحيل عليه الاقتراب من منزل حفصة أمحزون " لتركن الأسرة إلى الانتظار.
وعشية هدا اليوم وجد احد جيران العائلة الطفلة سامية هائمة في الشارع وفاقدة لذاكرتها حيث لم تستطع تذكر اسمها أو عائلتها ..
وقد رفضت الطبيبة بالمستشفى الإقليمي معاينتها طالبة من العائلة التوجه إلى مركز الأمن وهو ما تم بالفعل .
وعند التحاق أعضاء مكتب فرع الجمعية بمركز الأمن وجدناهم في انتظار سيارة الإسعاف لتقل الطفلة إلى المستشفى من جديد ونحن في انتظار الفحوصات الضرورية .
وقد عاينا الطفلة بالمستشفى حيث كانت فاقدة للذاكرة ولم تتعرف على احد من عائلتها ويتعذر عليها الكلام وتقوم بحركات تنم عن تناولها لمخدر قوي ما , وآثار جرح على معصمها يوحي من النظرة الأولى وكأنها حاولت الانتحار ....
ومكتب فرع الجمعية المغربية لحقوق الإنسان بخنيفرة وهو يتابع حالة هده الطفلة يدعو إلى التعامل مع هدا الملف بمسؤولية وجدية وان لايكون مصيره شبيها بمصير ملفات سابقة...
عن المكتب.
-- ADDARI EL MUSTAPHA PRESIDENT AMDH SECTION KHENIFRA


Commentaire de Azim Moslih, 19/9/2009

Que dire de plus que «hada hram» et «hchouma». Ce qui est arrivé à Mlle Soumia Attar est trop grave pour ne pas être condamné de toutes nos forces. Alors honte à vous Hafsa. Et ma solidarité avec la famille Attar.
CE QUI EST ARRIVÉ ne grandit ni la famille royale, ni la police, ni le système de santé du Maroc. Cela montre sans la moindre fumée qu'en fait le peuple marocain vit, hélas, encore sous le joug d'un gouvernement de Moyen-ÂGE.
Evidemment pour cette Hafsa, il est clair qu'elle se pense au-dessus des lois et de tous. En laissant libre cours à ses agissements criminels et inhumains, les autorités portent atteinte d'abord et avant tout à l'image du roi lui-même. Elles donnent du roi l'image de quelqu'un qui se fout «royalement» de son peuple et de ses malheurs, lui qui a déployé des trésors de patience et d'or pour redorer le blason de la monarchie et ainsi se mériter le titre flateur de «roi des pauvres». Alors, tant qu'il laisse faire cette folie agissante de Hafsa, il continuera de se nuire. C'est pourquoi il est plus que temps que le roi lui-même intervienne dans les plus brefs délais pour mettre un terme définitif à ces agissements.
Pour la police, c'est problématique de laisser faire de tels agissements criminels sans réagir. Quelle crédibilité après cela?
Pour le système de santé, c'est consternant de voir un médecin refuser de faire son travail, le travail pour lequel il est payé par les citoyens. Évidemment, je connais très bien le fonctionnement des choses au Maroc et je sais très bien les motivations des agissements de la police ainsi que de l'institution médicale, mais de là à laisser faire à ce point-là c'est de la lâcheté tout court.
Je ne peux vous laisser sans saluer le travail solidaire de l'AMDH. Vous les hommes et les femmes de l'AMDH, en soutenant notre peuple dans les moments difficiles, vous sauvez notre honneur à tous. Alors merci encore. Et prière de saluer la famille Attar de notre part à tous. Cordialement. Azim

Démantèlement de la «jungle» de Calais

COMMUNIQUE DE PRESSE

Par le Secours Catholique, 17/9/2009

Le Secours Catholique dénonce une opération de communication pas à la hauteur des enjeux.
Suite aux annonces faites hier au soir par M. Eric Besson, ministre de l’Immigration, concernant la situation des migrants à Calais, le Secours Catholique réaffirme que le démantèlement de la « jungle », située dans cette ville, ne réglera en rien le problème de fond. Ces centaines d’hommes, femmes et enfants fuient les persécutions et la misère qui règnent dans leur pays pour tenter une vie meilleure en Europe. L’association appelle de nouveau les pouvoirs publics nationaux et locaux à prendre leurs responsabilités afin d’assurer
des conditions de vie sauvegardant la dignité des migrants.

Présent et actif à Calais et dans sa région depuis plusieurs années, le Secours Catholique, outre son action quotidienne sur le terrain, permet aujourd’hui à 170 demandeurs d’être domiciliés pour demander l’asile. Parmi eux, seule une cinquantaine a, à ce jour, obtenu une autorisation provisoire de séjour et pour certains un hébergement en CADA (centre d'accueil pour demandeurs d'asile) qui peut prendre plusieurs semaines avant de se concrétiser. C’est pourquoi, l’association insiste pour que toute personne qui fait la démarche de demander l’asile, ait la garantie d’obtenir un hébergement rapide en CADA.

Par ailleurs, parmi les 170 personnes concernées, plus de la moitié se heurte à la procédure de Dublin du fait que leurs empreintes ont pu être relevées au fil de leur parcours, les menaçant de ce fait d’être renvoyés en Italie ou Grèce, pays où les pratiques d’asile sont régulièrement dénoncées par les organisations internationales.


C’est pourquoi, le Secours Catholique demande que la France suspende l’application du règlement Dublin pour étudier elle-même les demandes d’asile et garantir l’hébergement des candidats. Une telle attitude permettrait sans doute d’inciter d’autres migrants présents à Calais, à entamer des démarches similaires et les soustraire ainsi aux passeurs et à des conditions de vie indigne.

Enfin, l’équipe calaisienne de l’association constate que depuis plusieurs semaines la « jungle » de Calais abrite temporairement moins de personnes. Ces migrants se dispersent vers d’autres régions françaises où vers des pays du Nord de l’Europe, déplaçant de fait le drame des migrants sans y apporter de réponse quant à leur droit à vivre dignement et en sécurité.

Contacts presse : Département relations-médias, tél. 01 45 49 73 23

C'est par là qu'arrive le salut

Par Ali Fkir,18/9/2009
Le peuple marocain est pris en tenaille: d'un côté l'islamisme politique qui cherche à s'imposer à la société par le biais de la religion, à replonger le peuple dans le gouffre des ténèbres médiévales, d'un autre côté un régime théocratique dont la légitimité n'a pour support que la religion et l'appareil répressif de l'Etat .


Le comportement du citoyen, de la citoyenne, est conditionné par le sacré.

La jeunesse n'a aucun espace pour s'exprimer librement, pour s'épanouir...On étouffe au Maroc! Ce n'est que dans ce cadre là qu'il faut situer l'initiative de jeunes de Casablanca et de Mohammedia relative à "la tentative de casser la croûte" publiquement en plein mois de jeûne. C'est un cri qui vient des profondeurs de la société marocaine qui suffoque sous le poids du despotisme politico-idéologique imposé.
N'allez pas chercher des explications ailleurs : elles sont inhérente à notre système de valeurs médiévales, à notre édifice social de classes, à notre régime politique antidémocratique, à notre organisation économique de rente...
L'initiative de ces jeunes, les réactions qu'elle a suscitées, constituent un véritable filon pour les sociologues sérieux, pour les politiciens conséquents... pour mieux comprendre les mutations profondes de notre société.
Le côté comique de cette "affaire" est constitué par les réactions de certains partis tels que PAM, UC, MP, PI, USFP, PPS....ces partis sont connus pour leur option "moderniste", or ils se retrouvent aujourd'hui à l'avant garde du mouvement pour le lynchage des jeunes "non jeûneurs" au nom de la défense des "valeurs sacrées" du pays : l'islam, la monarchie et l'unité territoriale. Ismaïl Alaoui (leader du PPS ex PLS lui-même ex parti communiste marocain, qui se veut toujours communiste) déclare à la presse qu'il récite du coran avant de dormir, qu'il partira bientôt à la Oumra en Arabie Saoudite. Des jeunes de l'USFP (parti de Mehdi Ben Barka auteur de l'Option Révolutionnaire) ont appelé à manifester contre les " non jeûneurs"... Je n'en reviens pas!
Ces "cachez moi ce sein que je ne saurais voir", se donnent en ridicule spectacle.
En piètres comédiens, ils ne font que le bonheur du cheikh Abdeslam Yassine, le zaïm des islamistes radicaux, qui doit bien rire malicieusement (dans sa barbe) devant les gesticulation grotesques de ces tartuffes.
Quelle que soit notre façon de voir, quelle que soit notre appréciation de la forme de l'acte, nous ne pouvons en aucun cas ignorer ce SOS lancé par la jeunesse marocaine qui ne cherche qu'à respirer un peu d'air moins pollué.
Certe, c'est du jamais vu dans l'histoire du Maroc, c'est "choquant", mais c'est un signe avant-coureur d'un débat idéologique prometteur qui ne pourra qu'être bénéfique au peuple marocain.
L'esprit sclérosé ralentit, sinon freine la marche de l'Histoire, l'esprit rebelle libère les énergie stimulant ainsi l'épanouissement.
N'ayons pas peur ni du nouveau, ni du changement! c'est par là qu'arrive le salut!
Commentaire d'Azim Moslih
Bonjour Ali,ton message est intéressant à plusieurs titres. Je me contente ici de deux ou trois éléments à discuter ou préciser.
Premièrement: d'entrée de jeu, sache que, comme démocrate libéral (au sens américain), je défendrai toujours et jusqu'à mon dernier souffle les droits humains, y compris celui de conscience (croire ou ne pas croire), et le droit d'expression même des gens avec qui je pourrai être en désaccord idéologique ou politique. D'où ma condamnation ferme de ce qui est arrivé à nos «jeûneurs» en plein mois de Ramadan. Cela dit, vue le fameux article 222, leur arrestation ne m'a pas surpris.
Deuxièmement, les fondements du despotisme royal ne se limitent pas à la religion et à un appareil répressif de l'État. C'est plus complexe que laisse entendre ce schéma. Tu peux y ajouter, entre autres, une certaine «servitude volontaire» assez répandue dans la population marocaine, toutes classes sociales et couches culturelles confondues. Et l'islamisme est une continuation d'un tel fait culturel.
Troisièment, ces groupes politiques que tu as mentionnés n'ont de «progressistes» et de «modernistes» que le nom. Ils sont tous des groupes conservateurs. Pour s'en rendre compte, il suffit de regarder leur comportement et non leur rhétorique. Pour le Parti communiste en particulier, c'est une farce grotesque.. D'ailleurs, plusieurs de ces partis sont condamnés à disparaître à moyen terme. J'en dirai davantage dans une autre occasion. En attendant, le mieux que l'on puisse faire, c'est de les laisser livrer à eux-mêmes. Ils ont tout pour s'auto-détruire et c'est ce qui est en train d'arriver.
Quatrièmement, tu as raison pour notre jeunesse. Notre pays est un cimetière pour la jeunesse. Dans un royaume contrôlé par les viellards (au sens politique et culturel), point de place pour la jeunesse. Alors, s'il y a quelqu'un qui puisse sauver notre pays, c'est bien nos jeunes. Cordialement.

Répression violente à El Aaiun (Sahara Occidental)

Par APSO Amis du Peuple du Sahara Occidental, 17/9/2009

Communiqué de presse.

Des manifestations pacifiques Sahraouies ont été violemment réprimées par les forces de polices marocaines le 15 septembre à El Aaiun, le 16 à Boujdour et le 17 à Smara, villes du Sahara Occidental occupé.Les manifestants revendiquaient leur droit à l’autodétermination et à l’indépendance de leur pays.Cette revendication est strictement conforme au droit international clairement exprimé par les multiples résolutions de l’ONU et du Conseil de Sécurité depuis 1975, dûment contractualisé lors de l’accord de cessez-le-feu en 1991 entre le Maroc et le représentant officiel des sahraouis, le front Polisario.
APSO - Réseau Sud de la France, est une organisation française très attachée aux valeurs des droits de l’homme et de l’enfant, et au respect universel du droit international.Nous exprimons notre soutien à tous les blessés, enfants, jeunes et adultes. Les exactions perpétrées dans la rue, lors des interpellations ou perquisitions abusives sont indignes d’un royaume qui se dit démocratique. L’ampleur de ces manifestations, la résolution des participants démontrent la solidité et la popularité de la revendication Sahraouie pour l’indépendance. Il est inacceptable que la violence soit ainsi constamment opposée à l’expression d’un droit légitime, dont l’application est sans cesse différée. La responsabilité de l'ONU et de la communauté internationale est pleinement engagée, sur le plan juridique et moral, dans ces actes systématiquement répétés à huis clos par le Maroc contre des civils sans défense.
APSOlument@yahoo.fr

jeudi 17 septembre 2009

Tu laboures la mer

لمن كتعود زبرك يا داود خالد الجامعي


Par Khalid Jamaï, 17/9/2009


Choquante, inadmissible, humiliante, indécente est la photo publiée à la une du quotidien « El Jarida El Oula ».
Photo qui nous fait remonter au temps d’un Moulay Ismail et de ses horreurs/
لقد تسيب المخزن*


Désormais, nul ne peut plus prétendre que le Maroc est un Etat de droit géré par des lois.
Désormais, nul ne peut plus affirmer que dans « Le plus beau pays du monde » existe une autorité judicaire ou une quelconque séparation de pouvoirs


Nul doute que nous sommes revenus aux temps obscurs où on exhibait les prétendus criminels dans les rues, nus ou à demi nus, enchaînés sous les huées et les insultes de la populace


Je ne dis pas le peuple, car grande est la différence entre les deux termes.
La populace est sanguinaire, impitoyable, aveugle et pend avec la même facilité qu’elle applaudit et dont, très vite, on peut flatter les plus bas instincts


Ce qui s’est passé à Fès est immonde, innommable.
Spectacle jailli de la nuit des temps qui a déjà fait le tour du monde grâce aux milliers de sites, à leurs têtes : Face book, Yoo tub et autre Hespress.


Le monde découvrira une nouvelle facette de la nouvelle ère
Facette cauchemardesque.


Ceux qui ont été exhibés, sous les regards hilards de certains policiers sensés représenter la loi et la justice, sont des concitoyens qui ont des droits qui doivent être respectés intégralement.
Selon les lois qui régissent, en principe, ce pays, ces citoyens doivent jouir de la présomption d’innocence. En un mot, ils sont innocents car aucun tribunal ne les a encore déclarés coupables et condamnés et ce , à la suite d’un procès équitable.


C’est dire que ceux qui ont ordonné, organisé et participé à cette exhibition doivent répondre de leurs actes devant la justice, ces actes constituant autant de violations de la loi.
Ils sont coupables de s’être substitués au procureur du roi, au juge d’instruction, au juge assis et ont fait fi de tous les droits de la défense.


Ce comportement n’a rien à envier à celui qui régnait au temps de la Siba.


Que l’on se rappelle, sous le règne de Moulay Hfid, le dissident Jilali Ben Ben Driss surnommé Bou Hmara, dit aussi le rogui qui, après avoir été exhibé dans une cage, fut torturé une dernière fois et exécuté par dépeçage en public, puis livré aux fauves.


Qu’on accepte, aujourd’hui, ces pratiques, et demain, nous autres citoyens et citoyennes, nous nous retrouverons à subir le même sort.
Ainsi, s’installe la Siba.
Ainsi s’installe la Fitana.
و الفتنة أشد من القتل**


Et dire qu’il y a è peine quelques semaines, le souverain prononçait un discours dont le thème central a été la nécessité de réformer en profondeur la justice et d’instaurer une véritable séparation des pouvoirs.
و لكن لمن كتعود زبرك يا داوود ***

* L’anarchie est désormais au sein du mahgzen
**L’anarchie est pire l’assassinat
*** Expression qui peut traduite par « Tu laboures la mer

Moyen-âge au Maroc...

Par Ali Fkir, 17/9/2009




Au temps des sultans, on faisait circuler dans les quartiers de la ville de Fès les opposants politiques, des "détenus de droit commun" presque déshabillés, ligotés, zébrés de coups de fouet...pour donner l'exemple.



Aujourd'hui dans la même ville et dans les mêmes conditions, la police fait "la parade" avec son "gibier" . C'est le retour à l'esclavagisme. Pas de tribunal, pas de juge, pas d'avocat! En plein mois de Ramadan (le mois de la tolérance. Mon oeil!), on expose des détenus, nonobstant les délits ou crimes commis, à travers plusieurs quartiers de la Medina de Fès...pour terroriser la population
Quel scandale!



Par Zahra Ajaram,17/9/2009
Les quotidiens marocains ont publié aujourd’hui une photo choc : 4 détenus escortés par des policiers mains menottées derrière le dos torse nu en tournée dans les quartiers de la médina à Fés, la soit disant capitale 3ilmiya du Maroc!!!!!!!
Quel que soit le crime commis, ces personnes ont le droit d’être présentées devant un tribunal, d’ être jugées par des juges assermentés, d’avoir un avocat pour leur défense.
La police s’est transformée en juge et a ordonné un jugement : Exhiber des accusés , les torturer psychiquement et physiquement, les insulter… etc et ce pour donner une soit disant leçon aux autres criminels de la ville.
Est-ce qu’il n’y a pas d’autres mesures à prendre pour combattre le crime ?
Est-ce que la police peut prendre des décisions pareilles ?


Imaginons qu’ils iront plus loin : Raser les têtes, Embellir les corps de katrane les mettre sur le dos d’ânes en position inverse et faire leur faire subir le tour de la ville ...


c’est choquant ce qui arrive au plusbeaupaysdumonde
.

Par Adib Abdesselam, 17/9/2009

Je dénonce vivement cet acte barbare et j'appelle les intelectuels, les défenseurs des droits humains et les militants toutes tendances confondues à dénoncer cette escalade vers le barbarisme et combattre pour un changement radical



Inquiétude de l'AMDH à propos de la répression subie par les jeunes du MALI


COMMUNIQUÉ DU BUREAU CENTRAL DE L'AMDH, 17/9/2009


Le bureau central de l’Association Marocaine des Droits Humains (AMDH) suit, avec grande inquiétude, les développements, à la suite de la décision d’un groupe de jeunes qui se sont organisés en mouvement appelé « Mouvement Alternatif pour les Libertés Individuelles » (MALI), d’organiser, dans la ville de MOHAMMADIA, une rencontre en vue de revendiquer l’abrogation de l’article 222 du code pénal ; dans ce cadre le bureau central enregistre ce qui suit :



ــ Les autorités sécuritaires de la ville de MOHAMMADIA n’ont pas respecté le droit à la libre circulation des personnes suscitées vu qu’elles ont été extradées de la ville
ــ L’incitation implicite à la violence, à travers la publication de l’Agence Maghreb Presse (MAP) du lundi 14 septembre d’une information comportant le nom d’un membre du mouvement, l’accusant d’être l’instigatrice et allant jusqu'à citer le nom de l’hebdomadaire avec lequel elle travaillait auparavant
ــ L’offensive inconsidérée menée par quelques organismes et quelques médias et qui constitue une menace réelle pour la sécurité physique de ces citoyennes et citoyens.
ــ Les menaces et harcèlements à l’égard des membres du mouvement « MALI » aussi bien de la part des autorités que des citoyens qui laissent planer le recours à la violence.
ــ L’arrestation de citoyens, dont font partie des journalistes, en rapport avec l’événement sans aucune formulation de l’objet de la poursuite



S’appuyant sur le référentiel universel des droits humains et notamment sur le Pacte International relatif aux Droits Civils et Politiques que le MAROC a ratifié depuis trente ans et plus précisément sur l’article 18, le bureau central de l’AMDH :



ــ Exprime son inquiétude quant au comportement répressif et menaçant des autorités devant cet événement qui s’inscrit dans le cadre de la liberté d’opinion et de croyance, faisant fi de leurs engagements en matière des droits humains tels que reconnus universellement
ــ Exprime sa solidarité avec les citoyennes et citoyens arrêtés et poursuivis du fait qu’ils ont exprimé leur opinion et leur position sur un sujet en rapport avec la liberté de croyance et demande la libération des détenus et l’arrêt de toute poursuite; l’ AMDH se déclare prête à soutenir celles et ceux qui seraient poursuivis judiciairement dans cette affaire .
ــ Lance un appel à toutes les forces vives du pays afin qu’elles adoptent une attitude mûre et démocratique envers cet événement et qu’elles évitent les déclarations haineuses et populistes
ــ Réclame avec force l’adéquation des lois marocaines, et parmi elles la constitution, avec les pactes internationaux sur les droits humains que le MAROC a ratifiés et en prenant en considération la primauté de ces pactes sur la législation locale comme l’a recommandé l’instance Equité et Réconciliation elle-même.

AMDH : Rue AKensous, imm 6, n°1, Avenue Hassan II Quartier Diour Jamaa, près du AutoHoll, RABAT
Tel: (+212)37730961 – Fax: (+212)37738851 Email:
http://fr.mc245.mail.yahoo.com/mc/compose?to=amdh1@mtds.com – site-web: http://www.amdh.org.ma/
ONG constituée le 24 juin1979- reconnue d'utilité publique (décret n° 2.00.405 du 24 Avril 2000)

Kafka est-il marocain ??

Par Ali Kfir, 17/9/2009
DU KAFKAïSME...Sur la demande d'Ibtissam Lachgar ( "impliquée" dans l'affaire "des non jeûneurs"), des membres de l'AMDH-section de Mohammedia- dont le président Abdellah Mesdad, se sont rendus à la gare de Mohammedia pour l'accompagner au commissariat.
Elle devait arriver à 13h19 du jeudi 17 septembre 2009. Les militants de l'AMDH ont été surpris par l'encerclement de la gare par les forces de "l'ordre". A 13h22 les militants de l'AMDH ont accueilli Ibtissam et s'étaient dirigéEs vers la voiture pour aller au commissariat. A ce moment là une quinzaine de "policiers" en civil se sont présentés voulant arrêter la jeune "recherchée". Abdellah Mesdad leur a donné toutes les explications. Après des coups de fils par ci, par là, une voiture banale (civile) arrive et mène la jeune Ibtissam "au commissariat" malgré l'opposition des militants de l'AMDH. Les "kidnappeurs" ont dit aux militants des droits humains: "suivez nous en voiture au commissariat si vous voulez".. C'était à 13h40mn. Au commissariat, les représentants de l'AMDH ont demandé à voir un responsable. Après une heure d'attente sans résultat, ils se sont dirigés vers le tribunal voir le procureur du roi. Le tribunal était vide de son personnel (14h30): ni procureur, ni ses "adjoints"...
Donc Ibtissam Lachgar a été "enlevée" par des hommes en tenue civile, dans une voiture banale "civile" sans présentation aucune, et sans montrer un papier qui justifie l'arrestation de la jeune femme, et cela en présence des représentants de l'AMDH-section de Mohammedia et d'une quinzaine de "policiers" en tenue civile.
Rappelons que des militants de la section de Mohammedia, et sur la demande du père du jeune Mouktafi Abderrahim, étudiant à la faculté de lettre de Sidi Othman, et résident à Sidi Bernoussi, se sont présenté au commissariat pour demander des nouvelles du jeune officiellement arrêté par la police de Casa et emmené à Mohammedia selon la même police. La police de Mohammedia nie avoir dans ses locaux le jeune Abderrahim.
Où se trouve Abderrahim? Où se trouve Ibtissam?
Fkir Ali (17/09/2009 à 18h22)

Honni soit qui MALI pense ou : le Maroc n'est pas l'Iran

Par Ayman El Kayman, 15/9/2009

Un jour Jeha était assis devant une rôtisserie et aspirait l’air avec un air de satisfaction goulue. Le rôtisseur sortit de son échoppe et demanda : « Que fais-tu, Jeha ? » Celui-ci répondit : « Je me repais des fumets de ta rôtissoire ». « Ah, alors, mon gaillard, il va falloir que tu me paies ». « Bien sûr », répondit Jeha, et sortant de sa poche quelques piécettes, il les fit tinter sur le pavé : « Voilà, je pense que le son de mes pièces est le bon prix pour l’odeur de tes rôtis »


C’est une de ces infos du genre « incroyable mais vrai » comme seul le royaume enchanté du roitelet noceur et milliardaire – mais oui, vous savez bien de qui je veux parler, le pote à Djamel Debbouze – peut en livrer :


15 jeunes gens qui s’étaient donné rendez-vous dimanche 13 septembre devant la gare de Mohammedia, au sud de Casblanca, avec l’intention d’aller pique-niquer en forêt, ont été arrêtés par la police bien avant d’avoir pu déballer leurs sandwiches. Ils ont été, dans les heures qui ont suivi, condamnés à des peines allant d’un mois à douze mois de prison ferme, en application de l’article 222 du Code pénal marocain, qui interdit "le non-res­pect du jeûne par les Mu­sul­mans sous peine de trois mois d'in­car­cé­ra­tion".

Le Conseil des Oulémas a commenté cette « ten­ta­tive de rup­ture pu­blique du jeûne par un groupe d'agi­ta­teurs, en vio­la­tion de l'un des pi­liers de l'Islam, ar­guant que cela s'ins­crit dans le cadre de l'exer­cice des li­ber­tés in­di­vi­duelles », et mis en garde contre " les ré­per­cus­sions de ces actes sur la vie de la oumma".
Ainsi donc, une quinzaine de sandwiches tirés du sac en plein jour durant le Ramadan mettrait en danger la vie, la sécurité et la sérénité d’un miliard et demi de Musulmans. Eh ben, dis donc, elle est mal barrée, la Oumma, dans ce cas!!!...
On croit rêver.

Ainsi donc, le royaumelet voudrait faire concurrence à la Pétrosaoudie et transformerait subrepticement sa police – qui, comme tout le monde le sait, est composée des meilleurs Musulmans de la planète – en police religieuse.

Mais alors, les démocrates, les laïcards, les défenseurs de la veuve et de l’orphelin afghans, gazaouis, iraquiens et cachemiris opprimés par de sméchnats barbus, vous qui êtes prêts à donner le prix Nobel à toute Musulmane arborant string et minijupe au nom de la liberté, où êtes-vous, où sont vos lettres ouvertes, vos pétitions, vos rassemblements devant les ambassades et consulats du Maroc ?

Et que fait donc Miss Rama Yade ? (Oh pardon, j’oubliais qu’elle n’est plus secrétaire d’État aux droits de l’homme mais aux Sports ; ça ne fait rien, elle pourrait militer pour faire reconnaître comme nouvelle discipline olympique la course de fond de non-jeûneurs poursuivis par la police).
Je ne vous entends pas. Quoi ? Qu’est-ce que vous grommelez ? Quoi ? Que le Maroc, ça n’est pas l’Iran ? Ah bon ? Que le Roi est notre ami ? Ah bon. Je crois que je comprends.

Pourtant le MALI, Mouvement Alternatif pour les Libertés Individuelles, a tout pour vous plaire : d’abord il est dirigé par deux femmes modernes, Zineb Razhoui et Betty Lachgar. Ensuite, il a à première vue tout l‘air d’être un groupe de défense de la sacro-sainte laïcité comme vous les aimez. Mais bon, il n’a pas l’air de susciter votre enthousiasme. Et à seconde vue, on croit comprendre pourquoi.

Peut-être est-ce parce qu’il déclare ne pas être « un groupe anti-islam », mais être « pour la liberté de culte, et si nous revendiquons la suppression d’un article liberticide du code pénal (art.222), nous sommes également solidaires des citoyennes tunisiennes qui se font lyncher pour avoir mis le hijab, ou des Tunisiens qu’on harcèle sur le chemin de la mosquée… »
Décidément, ces dames, Zineb et Betty, n’ont pas compris comment il fallait s’y prendre pour devenir des martyres riches et célèbres dans la république enchantée des droits de l’homme. Il ne fallait pas annoncer que vous alliez sandwicher en forêt, mais que vous alliez faire un strip-tease devant la Mosquée Hassan II à l’heure de la grande prière ! Peut-être alors l’OTAN vous aurait-il apporté un appui aérien, avec la bénédiction des

redekersifaouiphilippevalglucksmannhenrilevygeertdewildershayyanhirsiali !!!
Ceci dit, imaginez que ces 15 jeunes gens auraient été des habitants de Téhéran et non pas de Casablanca et qu’ils aient subi la moitié du quart du sort subi par nos MALIstes : ça aurait fait l’ouverture de tous les journaux télévisés, de CNN à France24, pendant au moins 48 heures, et les déclarations de condamnation auraient fusé de toutes les capitales du monde libre. Mais bon, les MALIstes ne sont que de vulgaires sujets de SM M6. Donc, silence radio. Circulez, ya rien à voir, rien à bouffer, rien à espérer.
Dans ce royaumelet-là, c'est Ramadan 365 jours par an. Un drôle de Ramadan, sans Nuit du destin...

Bonne semaine, quand même !
Que la Force de l’esprit soit avec vous !
...et à mardi prochain !

ya oumatan...!!

par Samira Kinani, 16/9/2009

ya oumatan dahikate.............

c la Razzia dans certaines presses
ELalam ds sa première page dit"ils ne sont pas de nous"
les oulémas condamnent
c presque des appels au meurtre
la chasse aux sorcières bat son plein!!!
des lettres anonymes
des menaces de mort
"tayar lmoustakbal" s'apprête à manifester!!!
aw,ach waka3 ga3?????
des jeunes gens ont crée un groupe virtuel"mali"
voulant dénoncer la schizophrénie ambiante
dominante dans le bled
:attention des mécréants touchent à l'islam
à les entendre
doréanavant qui ne fait pas sa prière à l'heure
devrait être flagellé
comme en saoudie
avec lmouttawi3ine!!!!
c'est le seul danger avec un grand D
que court l bled
y a pas de pauvreté
y a pas de hausse de prix
y a pas de licenciement d'ouvriers
y a pas d'arrestations
walou
y a que ces jeunes
qui,bien sûr
selon la bonne presse
de qui on sait
serait dirige de l'extérieur
pour semer la fitna au pays!!!!!
wa baz
mais ces jeunes ont eu le mérite
ces jeunes ont eu le courage
de dénoncer la lâcheté
de dénoncer l'hypocrisie
même de ceux qu'on dit de l'élite!!!!
ils remettent sur le tapis
cette question
qu'il est plus que temps de mettre sur le tapis
"de quel droit doit on imposer à beaucoup de cacher leurs croyances??"
et ça gêne qui
que d'autres ne pratiquent pas
on ne devient rigoureux
sbhan lah
que dans tokkousse!!
ça m'aurait rendu fière
de voir cette grande indignation
quand 40 ouvriers ont été arrêtés hier!!
ça m'aurait émue jusqu'aux larmes
de les savoir aux aguets
a la moindre atteinte de la dignité
quand Aicha mourut devant leurs yeux!!
non
c daba
c l'appel à la guerre sainte!!!!
c l'appelle aux plus vils instincts de haine
d'intolérance
c l'appel a plus d'hypocrisie
de faire semblant
quand ça venait d'en haut
on comprenait
y a des intérêts à sauver
mais que des ceux qui se disent de la société civile s'y mettent!!!!
notre pays
a besoin de se voir tel qu'il est
avec ses différences
avec ses tares
avec ses qualités
on est très différent
et c ce qui fait qu'on est un peuple
on est pas un ramassis de machines
obligés de faire les mêmes gestes
en mm temps
sans souvent savoir pourquoi
alors de grâce
au lieu de crier au crime
criez plutôt à la discussion
à la compréhension

Liberté de culte garantie par la constitution, ou application de l'article liberticide 222 du code pénal ?

L'information:

Entendu sur France Inter le 16/9/2009
­
Des « non jeûneurs » s’affichent en public au Maroc, les autorités sévissent
APA Rabat (Maroc) Un groupe de "non jeû­neurs" a dé­frayé la chro­nique au Maroc en s'affi­chant en pu­blic près de Ca­sa­blan­ca, s'at­ti­rant les foudres des jeû­neurs et des au­to­ri­tés re­li­gieuses et sé­cu­ri­taires du pays, rap­porte mardi la presse ma­ro­caine.
Les po­pu­la­tions de Mo­ham­me­dia ( 25 km au sud de Ca­sa­blan­ca) ont été in­for­mées de "la ten­ta­tive de rup­ture pu­blique du jeûne par un groupe d'agi­ta­teurs, en vio­la­tion de l'un des pi­liers de l'Islam, ar­guant que cela s'ins­crit dans le cadre de l'exer­cice des li­ber­tés in­di­vi­duelles", in­dique un com­mu­ni­qué du Conseil des Ou­lé­mas. Les Ou­lé­mas du pays ont mis en garde contre " les ré­per­cus­sions de ces actes sur la vie de la oumma".La po­lice avait fait avor­ter di­manche cette ten­ta­tive de "rup­ture pu­blique du jeûne", menée par une jour­na­liste in
­dé­pen­dante, in­dique-t-on. Les "non-jeû­neurs" au­raient pro­je­té de de­man­der l'abro­ga­tion de l'ar­ticle 222 du Code pénal ma­ro­cain qui in­ter­dit "le non res­pect du jeûne par les Mu­sul­mans sous peine de trois mois d'in­car­cé­ra­tion".Des cou­rants "laïcs" très mi­no­ri­taires achoppent constam­ment sur la na­ture conser­va­trice de la so­cié­té, à plus de 99 pour cent mu­sul­mane.



Communiqué du M.A.L.I, 17/9/2009

(Mouvement Alternatif pour les Libertés Individuelles)

Depuis l’évènement du dimanche, la presse, les autorités et certaines forces politiques ont mené une campagne de lynchage et de diffamation contre les militants du Mouvement Alternatif pour les Libertés Individuelles.

Un retour sur l’évènement s’impose :Le groupe MALI s’est créé sur Facebook il y a quelques semaines autour d’une discussion sur la liberté de jeuner ou de ne pas jeuner, les premiers échanges se sont passés dans un cadre où règnaient tolérance et respect. Un évènement a été programmé, celui de pique-niquer SYMBOLIQUEMENT à la forêt de Mohammedia, et non devant la gare. Le but de l’action n’était nullement la provocation, mais était de mettre au courant les autorités que des citoyens avaient une revendication. Il n’est pas inutile de rappeler que le MALI n’est pas un groupe anti-islam. Nous sommes pour la liberté de culte, et si nous revendiquons la suppression d’un article liberticide du code pénal (art.222), nous sommes également solidaires des citoyennes tunisiennes qui se font lyncher pour avoir mis Al Hijab, ou des Tunisiens qu’on harcèle sur le chemin de la mosquée…
En revendiquant notre droit d’exister et de réfléchir de la sorte, nous insistons sur le fait que MALI n’est pas une organisation de provocation envers une quelconque sensibilité. Notre but est d’attirer l’attention sur des incohérences entre à la fois le Droit International, la Constitution marocaine, et l’arsenal juridique marocain, des incohérences qui coûtent cher aux citoyens marocains, et qui nuisent aux libertés collectives et individuelles.Nous, militants pour les libertés individuelles au Maroc, condamnons fortement les multiples interpellations policières et arrestations des membres activistes du MALI sans aucun motif valable. Nous condamnons également, l’emballement médiatique qui a accompagné l’affaire dans un flou total, induisant en erreur l’opinion publique, mettant en danger notre sécurité physique.


Arrestations et condamnations des non jeûneurs

Par Ali Fkir, 16/9/2009

Selon le journal "Assabah" proche de l'ONA, 15 citoyens viennent d'être condamnés à des peines variant entre 1 mois et 12 mois de prison ferme pour avoir bouffé publiquement en plein mois de ramadan. Ces personnes ont été arrêtées et condamnées à Casablanca et ne comprennent pas. les jeunes qui ont tenté de manger publiquement le dimanche 13 septembre à la gare de Mohammedia et qui font actuellement l'objet d'arrestation sans indications sur le lieu de leur détention.
Le père de l'étudiant MOUKTAFI Abderrahim (militant associatif) n'arrive pas à retrouver les traces de son fils, pourtant arrêté officiellement par la police.
Des bruits font état d'une vague d'arrestations pour non respect du jeûne.


Des réactions :
Par Azim Moslih, 16/9/2009

Tout en condamnant l'arrestation de ces «jeûneurs» en plein Ramadan et surtout la disparition de leur trace, je pense que leur arrestation et condamnation ne sont pas étonnantes dans la mesure où la loi marocaine est claire là-dessus. Mais restons quand même vigilant pour la suite de la chose.

Par Ahmed Assermouh, 19/9/2009

Je suis scandalisé par cette nouvelle et appelle à ce que cette condamnation soit portée à la connaissance du monde entier pour savoir que ce monde bien inféodé et bien préoccupé par la recherche humiliante de l’obtention « garantie » des énergies périssables laissant en attente les droits humains!!!
Le terrorisme religieux ne mène nulle part sauf au rejet catégorique et méprisable de la religion.
Je refuse d’aller au paradis les menottes aux mains !

A QUI LE TOUR ?

Par Ali Fkir, 17/9/2009

Les militants de l'ANDCM (association qui a plus de 70 sections et des milliers de membres) -section de Nador ont organisé le mardi 15 septembre 2009 un sit in de tout ce qu'il y a de pacifique, et cela dans le cadre de leur mouvement légitime pour leurs droits au travail, et pour la reconnaissance juridique de leur association de diplôméEs chômeurs victimes de l'exclusion et de marginalisation du fait qu'ils/qu'elles sont issuEs de couches populaires.
La réaction de l'appareil répressif fut violent. On dénombre plusieurs blessés.

Jeudi 11 septembre 2009 c'était le tour des protestataires contre la hausse des prix
Mardi matin 15 septembre c'était le tour des ouvriers de Khouribga qui protestaient contre leur licenciement abusif par le groupe étatique, l'OCP.
Mardi après-midi c'était le tour des jeunes diplômés en quête de leurs légitimes droits.
A QUI LE TOUR?
Dénonçons ces pratiques répressives qui visent en premier lieu les humbles et leurs et leurs enfants

سيناريو عنف هستيري غير مبرر :كانت الساعة تشير إلى حوالي الرابعة وعشرين دقيقة من بعد زوال اليوم الثلاثاء ( 15 شتنبر)، حينما وصل المعطلون إلى واجهة العمالة حيث يعتصمون على غرار ما دأبوا عليه في الأيام القليلة الماضية، بمجرد ما حاول هؤلاء الاقتراب من الرصيف "المقدس" المقابل لباب العمالة انهال عليهم رجال الأمن والمخازنية بالضرب في مختلف أنحاء الجسم وبشكل عشوائي، ولما وقع بعض من المعطلين على الأرض شرع هؤلاء في التنكيل بهم بالركلات العشوائية والرفس، دونما أي اعتبار للطبيعة السلمية لاحتجاجات هذه الفئة ومشروعية مطالبها.................................................... ................................................ خلف هذا التدخل إصابة عدد من المعطلين بكدمات في مختلف انحاء الجسم، ونقل اثنين من بينهم إلى المستشفى الحسني لتلقي الإسعافات الضرورية بعد إصاباتها في اليد والرجل. وفضلا عن القمع الذي جوبه به احتجاج المعطلين لم يسلم هؤلاء من الكلام الساقط لمسؤولين امنيين من قبيل " هاهوما ازوامـ... جاو"، " سير تقود"، "سير تقود ازامـ... لكبير" إلى غير ذلك من الألفاظ النابية التي كان يتلفظ بها مسؤول امني رفض إلى جانب آخرين كانوا برفقته طلب الإسعاف للمعطلين الذين كانا ممددين على الأرض وهما يتألمان من شدة الإصابة التي ألحقها
...........بهما رجال الأمن و المخازنية

mercredi 16 septembre 2009

L'Etat tente de briser la résistance ouvrière

Par Ali Fkir, 16/9/2009

Après le succès de la caravane de solidarité organisée par l'AMDH, les 850 ouvriers licenciés abusivement par l'OCP (groupe étatique), ceux-ci ont élaboré ainsi leur programme de lutte pour la 3ème semaine de septembre 2009:
- Le 15/09/2009: sit in devant les locaux administratifs de l'OCP à Khouribga de 10h du matin à 16h
- Le 16/09/2009: même forme de lutte et dans les mêmes conditions
- Le 19/09/2009: sit in au centre de la ville de 16h à 22h
- Le jour d'el aïd fitre (dimanche ou lundi) sit in de 7h à 10h

Rapport relatif au premier sit in:
- Les forces de répression ont quadrillé tout le quartier où se trouvent les locaux de l'OCP
- Les forces de répression se sont attaquées aux ouvriers et à leur famille, aux militants des droits humains, aux syndicalistes. Les badauds et autres citoyenNes ont eu leur part de la bastonnade. Plusieurs blesséEs. Arrestation de 41 ouvriers dont 4 du bureau syndical.
- Au commissariat: après prise d'empreinte, de photos...les ouvriers ont fait l'objet d'un interrogatoire provocateur : ton appartenance politique, qui vous pousse à agir ainsi, quels sont tes rapports avec les responsables de l'Union locale de l'UMT. Il faut quitter l'UMT et rejoindre un autre syndicat (rappelons qu'au Maroc il existe plus de 20 autres syndicats tous crées par des partis politiques ou par l'Etat pour affaiblir la combativité de la classe ouvrière). Aujourd'hui seuls l'UMT et la CDT ont une certaine légitimité ouvrière.
- Après ce calvaire, les 41 ouvriers ont été relâchés. Quatre d'entre eux sont poursuivis en liberté provisoire. Leur procès aura lieu le mardi 29 septembre 2009, il s'agit de:
OUASSIFI El Jilali, BELOUAFI Rachid, BOUKDIR Abderrahmane, FAKHOURI Omar
Au lieu d'agir en ETAT DE DROIT, l'Etat marocain a agi en Etat voyou. Il n'a fait en réalité que dévoiler sa nature de gendarme au service du patronat.
Dénonçons cette répression policière! Solidarisons nous avec les 850 prolétaire et avec leurs familles!

Succès d'une caravane

Par Ali Fkir, 15/9/2009

Le succès de la caravane organisée le 13 septembre 2009 par l'AMDH a dépassé les attentes. On prévoyait "moins" pour les raisons principales suivantes:
- Le jeûne du ramadan
- La réaction répressive éventuelle de l'Etat: c'est la première fois qu'une telle caravane est organisée pour se solidariser "sur le tas "avec des prolétaires.

Khouribga était toujours sous la haute surveillance. En 1971, au cours d'une longue grève des ouvriers de la même ville, un comité d'ILA AL AMAM (organisation marxiste léniniste clandestine) avait rendu visite (dans le plus grand secret ) à un comité d'ouvriers militants, et malgré toutes les précautions prises nous fûmes arrêtés à la sortie de Khouribga. Mais on l'avait échappé belle, car aucun d'entre nous n'était recherché. Serfaty était connu comme intellectuel en désaccord avec son ex parti le PLS (ex PCM) de Ali Yata, moi comme militant étudiant en désaccord avec le même parti .
38 ans après je retrouve les ouvriers de Khouribga, mais cette fois ci nous ne sommes pas que 3, mais des centaines; nous ne sommes pas là pour rencontrer une dizaine de militants ouvriers, mais des centaines de prolétaires et des milliers de "khouribgaisEs"; dans le temps, l'AMDH n'existait pas, les marxistes travaillaient dans la clandestinité et leur influence était faible en dehors de la "jeunesse scolarisée", le mouvement ittihadi avait d'autres chats à fouetter (bagarres internes entre la direction syndicale et la direction politique, entre UNFP de Casa et UNFP de Rabat, entre les monarchistes légalistes et les républicains qui prônaient la lutte armée...), le PLS (ex PCM) n'était que l'ombre de lui-même. Aujourd'hui, les mouvement sociaux en général et le mouvement ouvrier en particulier peuvent compter sur le soutien et la solidarité des militants de l'AMDH, des organisations progressistes...d'ailleurs les militantEs de ces organisations sont enfantés par ces mouvement et y jouent un rôle d'avant-garde non négligeable.
Malgré le jeûne du ramadan, malgré le quadrillage de la ville par les différents corps de répression....les 850 prolétaires, leurs familles, l'AMDH, les organisations progressistes..., surmontant les divers obstacles, ont réussi l'inoubliable caravane de solidarité.

La lutte déterminée des masses conscientes et organisées reste notre voie stratégique vers la victoire. Nous avons écarté de nos choix la stratégie du changement à travers les "institutions démocratiques" makhzaniennes (même en y participant), de même que les aventures élitistes et putschistes qui méprisent aussi bien le rôle déterminant des travailleurs dans le changement révolutionnaire, que la théorie révolutionnaire.

Une victime de licenciement abusif par terre: je n'ai rien à perdre!

lundi 14 septembre 2009

L'autre Maroc : Khouribga, la résistance au pluriel

Par Ali Fkir, 14/9/2009

Ils, elles étaient des centaines de militantEs à venir de différentes région du Maroc pour manifester sur place leur solidarité avec les 850 ouvriers licenciés abusivement par SEMSI-Régie (filiale du premier groupe économique marocain, l'OCP), et avec leurs familles qui se retrouvent aujourd'hui dans une situation dramatique.
Khouribga, la capitale minière du pays, n'a jamais connu ce type de rencontre chaleureuse entre des militantEs des droits humains, des militantEs de gauche en général et de la gauche marxiste en particulier, et des prolétaires en lutte pour des droits légitimes.
Les militantEs venuEs des autres régions du Maroc s'étaient retrouvéEs à 13h près de "magana" (avenue Moulay Youssef), et puis le cortège s'était dirigé vers le centre de la ville, deuxième étape de l'itinéraire prévu par les organisateurs. Là, fut organisé le grand meeting, qui devrait se terminer à 15h pour laisser la place à la 3ème partie du programme établi, à savoir la marche vers les locaux de l'OCP.
Cette marche n'a pas eu lieu. Elle a été purement et simplement interdite par l'Etat. Des barrages de forces répressives ont empêché les ouvriers et leurs amis d'avancer. La police à cherché la bagarre pour mettre fin à la lutte des 850 ouvriers. Les organisateurs ont déjoué la manœuvre policière en se rassemblant dans la grande place de la médina scandant des slogans relatifs à la lutte et à la résistance ouvrière contre l'arbitraire. Les militantEs venus des autres régions n'avaient pas oublié qu'ils/elles s'étaient déplacéEs pour exprimer leur soutien aux victimes de l'arbitraire et non pour chercher ou provoquer des escarmouches avec les forces de répression. Le comité organisateur constitué des ouvriers et des militants syndicaux locaux ont su éviter le piège policier.
La lutte déterminée de masse consciente et organisée est la voie de la victoire.
La colère de la populationIls étaient là les matous: c'est l'autre aspect de la contradiction. Pas de lutte sans répression. Pas de répression sans résistance. Merci Mao pour pour ton analyse relative à la contradiction.
Le militant Fekkak, toujours égal à lui-même.(...) Il a échappé par miracle à la mort en juillet 1971 suite à la tentative d'assassinat perpétrée par le directeur de la cité universitaire. Fekkak avait passé plusieurs semaines à l'hôpital .
Aujourd'hui, après que le mouvement ittihadi ait rejoint le camp du makhzen, ait abandonné sa ligne combative, ait renié son passé, ait effacé de sa mémoire les martyrEs... Fekkak, militant "organisationnellement" indépendant, est toujours là où il y a l'AMDH, ANNAHJ, et surtout là où il y a la résistance et la lutte.

Le visage de la solidarité humaine.
La militante Samira Kinani, s'adressant aux victimes de l'arbitraire au nom du bureau central de l'AMDH. Cette grande militante, "organisationellement" indépendante, ancienne militante syndicale de l'UMT, aujourd'hui militante des droits humains, se retrouve au milieu du monde phosphatier, retrouvant ainsi son enfance passé dans le monde du phosphate à El YOUSSOUFIA, autre centre minier du Maroc où travaillait son papa.